PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G19390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 379aa    MW: 41544.7 Da    PI: 4.8856
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G19390.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.6e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +lv +++++G  +W++ ++  g+ R++k+c++rw +yl
  LPERR04G19390.1 16 RGSWTPEEDMRLVAYIQKYGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding51.32.7e-1669131148
                      TSSS-HHHHHHHHHHHHHTTTT................-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg................tWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+e +++++++lG++                +W++Ia++++ gRt++++k+ w+++l
  LPERR04G19390.1  69 RGNFTAEEEETIIKLHALLGNKyvpttgfnfqwimdsaRWSKIASCLP-GRTDNEIKNVWNTHL 131
                      89**********************************************.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.171167IPR017930Myb domain
SuperFamilySSF466892.38E-2513127IPR009057Homeodomain-like
SMARTSM007174.1E-131565IPR001005SANT/Myb domain
PfamPF002493.1E-151663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-241770IPR009057Homeodomain-like
CDDcd001671.00E-101863No hitNo description
SMARTSM007175.9E-1368133IPR001005SANT/Myb domain
PROSITE profilePS5129413.03368135IPR017930Myb domain
PfamPF002496.5E-1469131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-2471135IPR009057Homeodomain-like
CDDcd001673.67E-1071131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNRGSWT PEEDMRLVAY IQKYGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTAEEEETI IKLHALLGNK YVPTTGFNFQ WIMDSARWSK IASCLPGRTD  120
NEIKNVWNTH LKKRVSTPEK KKKKEGGNKS RKKTTCSDVL VPSPSPSSST TTTTTTNFSS  180
GDSAGEQSMS INTSKEEEED KIEIPMIDPC SFDFDMLVDP VVPETFFPAM TSSPASPCSS  240
TSRGGVDTNT LLDLPEIVDL GPELWSIIDG DGDGEAPPPP ASSNAAAACE ANATVAATEE  300
TKDWWLEDLE KELGLWGPTD EYHCHLGPQG QQPGRVDPPP LPAVVEDPVS CYFQAGPTAA  360
TWQGHEPSAV MTSYQMDYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-241413525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139152KKKKKEGGNKSRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0701457e-97BT070145.1 Zea mays full-length cDNA clone ZM_BFc0138F01 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006653723.11e-168PREDICTED: myb-related protein Zm1-like
SwissprotP200241e-104MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A0D9W8V40.0A0A0D9W8V4_9ORYZ; Uncharacterized protein
STRINGOB04G30570.11e-167(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.12e-62myb domain protein 63